Atox1 Information

Designed and maintained by Tina D. Purnat (purnatt@ohsu.edu).
Last update: July 25, 2004.
The Lutsenko Laboratory, Department of Biochemistry and Molecular Biology, MRB 624, Mail Code L224,
Oregon Health & Science University, 3181 SW Sam Jackson Pk Rd, Portland, OR 97239-3098
503-494-7501 (tel), 503-494-8393 (fax)

This material is based upon work supported by the National Science Foundation
under grant number MCB-0110057. Any opinions, findings, and conclusions or recommendations
expressed in this material are those of the author(s) and do not necessarily reflect the views of the National Science Foundation.


		*ATOX1 Human copper chaperone*

Back to Lutsenko Lab Home Page Back to Copper Chaperones Main Page Atox1 ATP7B Lab Intranet		OMIM record \| ATOX1 sequence alignment \| Structure views \| ATOX1 and ATP7B \| PDB \| >gi\|7531045\|sp\|O00244\|ATOX_HUMAN Copper transport protein ATOX1 (Metal transport protein ATX1) MPKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGLE Structure of CuHah1. Monomer A is shown in blue and monomer B is shown in yellow. The copper ion is shown as a cyan sphere, and the four Cys residues in the two MT/HCXXC motifs are shown as ball-and-stick representations. a, Stereo view with the noncrystallographic two-fold axis running vertically. b, Viewed 90° from the orientation in (a), looking down the molecular twofold axis. [From Nat. Struct. Biol. 2000 Sep;7(9):766-71] [Login to see PDF of article] OMIM record \| ATOX1 sequence alignment \| Structure views \| ATOX1 and ATP7B \| PDB \|



	\| Home \| Interests \| People \| Publications \| Links \| ATP7B Information \| Tools\| Designed and maintained by Tina D. Purnat (purnatt@ohsu.edu). Last update: July 25, 2004. The Lutsenko Laboratory, Department of Biochemistry and Molecular Biology, MRB 624, Mail Code L224, Oregon Health & Science University, 3181 SW Sam Jackson Pk Rd, Portland, OR 97239-3098 503-494-7501 (tel), 503-494-8393 (fax) This material is based upon work supported by the National Science Foundation under grant number MCB-0110057. Any opinions, findings, and conclusions or recommendations expressed in this material are those of the author(s) and do not necessarily reflect the views of the National Science Foundation.